| Name
|
Amyloid beta/A4 Protein Precursor770 (740-
|
| Code
|
|
| The alias
|
Amyloid beta/A4 Protein Precursor770 (740-
|
| Sequence (single letter abbreviation)
|
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
|
| Sequence (three-letter abbreviation)
|
H-Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH (trifluoroacetate salt)
|
| A basic description
|
This peptide is the English (H6R) mutation of beta-amyloid, which accelerates fibrillation without increasing protofibril formation. The English and Tottori mutations alter Abeta assembly at its earliest stages, monomer folding and oligomerization, and produce oligomers that are more toxic to cultured neuronal cells than are wild type oligomers. The exchange of His6 by Arg influences the structure of the Cu2+ complex formed by Abeta peptides.
|
| solubility
|
|
| The molecular weight
|
3717.12
|
| Chemical formula
|
C162H243N45O52S2
|
| The purity
|
80%，90%，95%，98%，99%
|
| Weight
|
1mg,5mg,10mg,50mg,100mg,1g
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
D.C.Lu et al., Nat. Med., 6, 397 (2000)
C.Dumanchin-Njock et al., J. Neurochem., 78, 1153 (2001)
V.Galvan et al., J. Neurochem., 82, 283 (2002)
Y.Chen et al., J. Cell Biol., 163, 27 (2003)
D.C.Lu et al., J. Neurochem., 87, 733 (2003)
|
| The C-terminal
|
|
| The N-terminal
|
|
| Chemical bridge
|
|