Catalog peptides

Name Adrenomedullin (13-52), human
Code [154765-05-6]
The alias Adrenomedullin (13-52), human
Sequence (single letter abbreviation) SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2(C4&C9 bridge)
Sequence (three-letter abbreviation) H-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2?(trifluoroacetate salt)(Cys4 and Cys9 bridge)
A basic description Adrenomedullin-elicted cAMP antagonist and a more effective inhibitor than alpha-CGRP in terms of adrenomedullin- and CGRP-specific receptors.
solubility
The molecular weight 4533.17
Chemical formula C200H308N58O59S2
The purity 80%,90%,95%,98%,99%
Weight 1mg,5mg,10mg,50mg,100mg,1g
Storage conditions Store at -20°C. Keep tightly closed. Store in a cool dry place.
Annotation
Documents 文档
Figures 无图片展示
Reference Heaton, J. O. H. N., et al. American Journal of Physiology-Heart and Circulatory Physiology 268.6 (1995): H2211-H2215. Sone, Masahiko, et al. Peptides 18.8 (1997): 1125-1129. Hyman, Albert L., et al. American Journal of Physiology-Heart and Circulatory Physiology 43.4 (1998): H1218. Gumusel, Bulent, et al. American Journal of Physiology-Heart and Circulatory Physiology 274.4 (1998): H1255-H1263. Chu, Duc Quyen, et al. British journal of pharmacology 130.7 (2000): 1589-1596.
The C-terminal
The N-terminal
Chemical bridge (Cys4 and Cys9 bridge)

Collect from