| Name
|
Β-Endorphin, Human
|
| Other Name
|
|
| Sequence (Single letter abbreviations)
|
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
|
| Sequence（Three letter abbreviations）
|
{TYR}{GLY}{GLY}{PHE}{MET}{THR}{SER}{GLU}{LYS}{SER}{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}{ALA}{ILE}{ILE}{LYS}{ASN}{ALA}{TYR}{LYS}{LYS}{GLY}{GLU}
|
| Basic description
|
Potent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, b-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. β-Endorphin is released in response to painful stimuli and b-Endorphin has potent antinociceptive activity mediated through its action on μ receptors in brain and by μ and κ receptors in the spinal cord.
|
| Solubility
|
The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
|
| The molecular weight
|
3465.100
|
| Chemical formula
|
C158H251N39O46S1
|
| The purity
|
> 95%
|
| Storage conditions
|
Store the peptide at -20°C
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Kauser S, et al. Modulation of the human hair follicle pigmentary unit by corticotropin-releasing hormone and urocortin peptides. FASEB J. May 2006; 20(7): 882-895.
Bohm M, et al. Detection of functionally active melanocortin receptors and evidence for an immunoregulatory activity of alpha-melanocyte-stimulating hormone in human dermal papilla cells. Endocrinology. Nov 2005; 146(11): 4635-4646.
Kauser S, et al. A fully functional proopiomelanocortin/melanocortin-1 receptor system regulates the differentiation of human scalp hair follicle melanocytes. Endocrinology. Feb 2005; 146(2): 532-543
|
Β-Endorphin, Human
