| Name
|
Β-Amyloid (1-40), Rat
|
| Other Name
|
|
| Sequence (Single letter abbreviations)
|
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
|
| Sequence（Three letter abbreviations）
|
{ASP}{ALA}{GLU}{PHE}{GLY}{HIS}{ASP}{SER}{GLY}{PHE}{GLU}{VAL}{ARG}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}{ALA}{GLU}{ASP}{VAL}{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}{VAL}{GLY}{GLY}{VAL}{VAL}
|
| Basic description
|
The effect of beta-amyloid-(1-40) was investigated on long-term potentiation of glutamatergic excitatory postsynaptic field potentials recorded in the inner molecular layer in the rat dentate gyrus in vitro. In the presence of 200 nM beta-amyloid-(1-40) there was an increase in long-term potentiation of 51%. Basal synaptic transmission was not affected. These results provide direct evidence that a relatively low concentration of beta-amyloid-(1-40) increases synaptic plasticity.
|
| The molecular weight
|
4233.740
|
| Chemical formula
|
C190H291N51O57S1
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C.
|
| Annotation
|
HIV-I TAT Protein Peptide
|
| Documents
|
|
| Figures
|
|
| Reference
|
Head E, et al. Immunization with fibrillar Abeta(1-42) in young and aged canines: Antibody generation and characteristics, and effects on CSF and brain Abeta. Vaccine. Apr 2006;24(15):2824-2834.
Bazoti FN, et al. Noncovalent Interaction Between Amyloid-beta-Peptide (1-40) and Oleuropein Studied by Electrospray Ionization Mass Spectrometry. J Am Soc Mass Spectrom. Apr 2006;17(4):568-575.
Qin S, et al. System Xc- and apolipoprotein E expressed by microglia have opposite effects on the neurotoxicity of amyloid-beta peptide 1-40. J Neurosci. Mar 2006;26(12):3345-3356.
|
Β-Amyloid (1-40), Rat
