| Name
|
Peptide YY (PYY) (3-36), Human
|
| Other Name
|
|
| Sequence (Single letter abbreviations)
|
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
|
| Sequence（Three letter abbreviations）
|
{ILE}{LYS}{PRO}{GLU}{ALA}{PRO}{GLY}{GLU}{ASP}{ALA}{SER}{PRO}{GLU}{GLU}{LEU}{ASN}{ARG}{TYR}{TYR}{ALA}{SER}{LEU}{ARG}{HIS}{TYR}{LEU} {ASN}{LEU}{VAL}{THR}{ARG}{GLN}{ARG}{TYR}-NH2
|
| C-port
|
NH2
|
| Basic description
|
Peptide YY (PYY), a novel 36 amino-acid amidated hormone is a component of the complex neuroendocrine control process. This gut hormone (3-36), when infused into subjects, has been shown to reduce food intake in normal-weight and obese individuals. PYY (3-36) infusion also reduces the plasma levels of the hunger-promoting hormone ghrelin. PYY (3-36) levels have been shown to drop pre-meal and then increase post-prandially. In circulation, PYY (3-36) exists in at least two molecular forms: (1-36) and (3-36). PYY (3-36) selectively binds to Y2 receptors, and it has been found in human intestine and circulating blood.
|
| Solubility
|
The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
|
| The molecular weight
|
4049.480
|
| Chemical formula
|
C180H279N53O54
|
| The purity
|
> 95%
|
| Storage conditions
|
Store the peptide at -20°C.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Timothy H Moran, et al. Peptide YY(3–36) inhibits gastric emptying and produces acute reductions in food intake in rhesus monkeys. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2005; 288(2): R384-R388.
Prasanth K Chelikani, et al. Daily, intermittent intravenous infusion of peptide YY(3-36) reduces daily food intake and adiposity in rats. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2006; 290(2): R298-R305.
Frank H Koegler, et al. Peptide YY(3–36) Inhibits Morning, but Not Evening, Food Intake and Decreases Body Weight in Rhesus Macaques. Diabetes. Nov 2005; 54(11): 3198-3204.
Jennifer M. Rojas., etc. Central Nervous System Neuropeptide Y Signaling Via The Y1 Receptor Partially Dissociates Feeding Behavior From Lipoprotein Metabolism In Lean Rats. Am J Physiol Endocrinol Metab. 2012
|
Peptide YY (PYY) (3-36), Human
