| Name
|
Galanin, Human
|
| Other Name
|
|
| Sequence (Single letter abbreviations)
|
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
|
| Sequence（Three letter abbreviations）
|
{GLY}{TRP}{THR}{LEU}{ASN}{SER}{ALA}{GLY}{TYR}{LEU}{LEU}{GLY}{PRO}{HIS}{ALA}{VAL}{GLY} {ASN}{HIS}{ARG}{SER}{PHE}{SER}{ASP}{LYS}{ASN}{GLY}{LEU}{THR}{SER}
|
| Basic description
|
Galanin is a neuropeptide that has not been established as a member of any known family of neuropeptides despite repeated efforts to discover related peptides. Its actions are mediated via Gi-protein-coupled receptors and ion channels, usually producing inhibition of secretion of a transmitter or hormone in the nervous and endocrine system. In many respects, these inhibitory actions of galanin remind us of those of gamma-aminobutyric acid (GABA) and of neuropeptide Y (NPY). Galanin coexists with GABA, noradrenaline, 5-hydroxytryptamine (5-HT), and NPY in several regions of the brain.
|
| Solubility
|
The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
|
| The molecular weight
|
3157.410
|
| Chemical formula
|
C139H210N42O43
|
| The purity
|
> 95%
|
| Storage conditions
|
Store the peptide at -20°C. Keep container tightly closed.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Merchenthaler I, et al. Estrogen and estrogen receptor-{beta} (ER{beta})-selective ligands induce galanin expression within gonadotropin hormone-releasing hormone-immunoreactive neurons in the female rat brain. Endocrinology. Jun 2005; 146(6): 2760-2765.
Schauble N, et al. Human galanin (GAL) and galanin 1 receptor (GALR1) variations are not involved in fat intake and early onset obesity. J. Nutr. Jun 2005; 135(6): 1387-1392.
|
Galanin, Human
