| Name
|
Glucagon-Like Peptide (GLP) II, Human
|
| Other Name
|
Glucagon-Like PeptideII; Glucagon-Like Peptide 2; Glucagon-Like Peptide2; GLP II; GLPII; GLP 2; GLP2
|
| Sequence (Single letter abbreviations)
|
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
|
| Sequence（Three letter abbreviations）
|
{HIS}{ALA}{ASP}{GLY}{SER}{PHE}{SER}{ASP}{GLU}{MET}{ASN}{THR}{ILE}{LEU}{ASP}{ASN}{LEU}{ALA}{ALA}{ARG}{ASP}{PHE}{ILE}{ASN}{TRP}{LEU}{ILE}{GLN}{THR}{LYS}{ILE}{THR}{ASP}
|
| Basic description
|
Glucagon-like peptide 2 (GLP-2) is a recently identified intestinal epithelium-specific growth factor that has been shown to reduce the severity of inflammatory disorders of the intestine in rodent models. Currently Glucagon-Like Peptide 2 is used as a potential therapeutic agent for the human subjects with a broad variety of intestinal diseases characterized by intestinal damage and insufficiency.
|
| The molecular weight
|
3766.200
|
| Chemical formula
|
C165H254N44O55S1
|
| The purity
|
> 95%
|
| Storage conditions
|
Store the peptide at -20°C. Keep container tightly closed.
|
| Documents
|
|
| Figures
|
|
| Reference
|
Sams A, et al. Naturally occurring glucagon-like peptide-2 (GLP-2) receptors in human intestinal cell lines. Eur. J. Pharmacol. Feb 2006; 532(1-2): 18-23.
Chance WT, et al. The role of polyamines in glucagon-like peptide-2 prevention of TPN-induced gut hypoplasia. Peptides. Apr 2006; 27(4): 883-892.
Stephens J, et al. Glucagon-like peptide-2 acutely increases proximal small intestinal blood flow in TPN-fed neonatal piglets. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2006; 290(2): R283-R289.
|
Glucagon-Like Peptide (GLP) II, Human
