| Name
|
Brain Natriuretic Peptide (BNP) (1-32), Rat
|
| Other Name
|
BNP (1-32), rat
|
| Sequence (Single letter abbreviations)
|
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
|
| Sequence（Three letter abbreviations）
|
{ASN}{SER}{LYS}{MET}{ALA}{HIS}{SER}{SER}{SER}{CYS}{PHE}{GLY}{GLN}{LYS}{ILE}{ASP}{ARG}{ILE}{GLY}{ALA}{VAL}{SER}{ARG}{LEU}{GLY}{CYS}{ASP}{GLY}{LEU}{ARG}{LEU}{PHE}
|
| Chemical bridge
|
Disulfide bridge: Cys10-Cys26
|
| Basic description
|
Brain natriuretic peptide (type B natriuretic peptide) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. BNP is involved in blood pressure control and cardiovascular homeostasis.
|
| Solubility
|
Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
|
| The molecular weight
|
3452.940
|
| Chemical formula
|
C146H239N47O44S3
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C. Keep tightly closed.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Medvedev A, et al. Natriuretic peptide interaction with [3H]isatin binding sites in rat brain. Brain Res. May 2005; 1042(2): 119-124.
Yu YC, et al. Modulation by brain natriuretic peptide of GABA receptors on rat retinal ON-type bipolar cells. J. Neurosci. Jan 2006; 26(2): 696-707.
Jiang W, et al. Changes in production and metabolism of brain natriuretic peptide in rats with myocardial necrosis. Eur. J. Pharmacol. Jan 2005; 507(1-3): 153-162.
|
Brain Natriuretic Peptide (BNP) (1-32), Rat
