| Name
|
Chlorotoxin
|
| Code
|
[163515-35-3]
|
| The alias
|
Chlorotoxin
|
| Sequence (single letter abbreviation)
|
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2(Disulfide Bridge: Cys1-Cys4,Cys2-Cys6,Cys3-Cys7,Cys5-Cys8)
|
| Sequence (three-letter abbreviation)
|
H-Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Lys-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Lys-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-NH2?(trifluoroacetate salt)(Disulfide Bridge: Cys1-Cys4,Cys2-Cys6,Cys3-Cys7,Cys5-Cys8)
|
| A basic description
|
Kisspeptin peptides and its receptor, GPR54, play key roles in cancer and reproduction development. In mammals (except for the platypus), there is only one kisspeptin gene (Kiss1) present. In fish and some amphibians, two kisspeptin genes (Kiss1 and Kiss2) are common, and have been observed in zebra fish, goldfish, chub mackerel, and sea bass.
|
| solubility
|
|
| The molecular weight
|
3995.77
|
| Chemical formula
|
C158H249N53O47S11
|
| The purity
|
80%，90%，95%，98%，99%
|
| Weight
|
1mg,5mg,10mg,50mg,100mg,1g
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
DeBin JA, Strichartz GR. Toxicon 29 (11): 1403?8, (1991).
Deshane J, Garner CC, Sontheimer H . J. Biol. Chem. 278 (6): 4135?44, (2003).
|
| The C-terminal
|
|
| The N-terminal
|
|
| Chemical bridge
|
(Disulfide Bridge: Cys1-Cys4,Cys2-Cys6,Cys3-Cys7,Cys5-Cys8)
|