| Name
|
Urocortin III, human
|
| Code
|
[357952-09-1]
|
| The alias
|
Urocortin III, human
|
| Sequence (single letter abbreviation)
|
FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2
|
| Sequence (three-letter abbreviation)
|
H-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2?(trifluoroacetate salt)
|
| A basic description
|
This peptide has exhibited considerably higher affinity for both splice variants of the type 2 CRF receptor (CRF-R2) than for those of CRF-R1. The potencies of Ucn II (mouse) in activating CRF-R2a and CRF-R2b were almost the same to that of urocortin (rat).
|
| solubility
|
|
| The molecular weight
|
4137.9
|
| Chemical formula
|
C185H307N53O50S2
|
| The purity
|
80%，90%，95%，98%，99%
|
| Weight
|
1mg,5mg,10mg,50mg,100mg,1g
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
K.Lewis et al., Proc. Natl. Acad. Sci. USA , 98, 7570 (2001)
|
| The C-terminal
|
|
| The N-terminal
|
|
| Chemical bridge
|
|