| Name
|
Cecropin B
|
| Code
|
[80451-05-4]
|
| The alias
|
Cecropin B
|
| Sequence (single letter abbreviation)
|
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
|
| Sequence (three-letter abbreviation)
|
H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2?(trifluoroacetate salt)
|
| A basic description
|
31 amino acid peptide that is highly potent against Gram-negative bacteria but has a reduced activity against Gram-positive bacteria. A disruptive effect on bacterial membranes has been proposed as mechanism of antimicrobial activity.
|
| solubility
|
|
| The molecular weight
|
3834.7
|
| Chemical formula
|
C176H302N52O41S1
|
| The purity
|
80%，90%，95%，98%，99%
|
| Weight
|
1mg,5mg,10mg,50mg,100mg,1g
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
D. Andreau et al., PNAS, 80, 6475 (1983)
D. Andreau et al., Biochem., 24, 1683 (1985)
|
| The C-terminal
|
|
| The N-terminal
|
|
| Chemical bridge
|
|