| Name
|
Glucagon-Like Peptide (GLP) I (7-37)
|
| Other Name
|
Glucagon-Like PeptideI; Glucagon-Like Peptide 1; Glucagon-Like Peptide1; GLP-I; GLPI; GLP-1; GLP1; GCG peptide
|
| Sequence (Single letter abbreviations)
|
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
| Sequence(Three letter abbreviations)
|
{HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}{SER}{SER}{TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}{GLU}{PHE}{ILE}{ALA}{TRP}{LEU}{VAL}{LYS}{GLY}{ARG}{GLY}
|
| Basic description
|
GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells. It is a potent insulinotropic hormone.
|
| Solubility
|
Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
|
| The molecular weight
|
3355.680
|
| Chemical formula
|
C151H228N40O47
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C. Keep tightly closed. Store in a cool dry place.
|
| Annotation
|
Potent Insulin secretagogue.
|
| Documents
|
|
| Figures
|
|
| Reference
|
Schirra J, et al. Endogenous glucagon-like peptide 1 controls endocrine pancreatic secretion and antro-pyloro-duodenal motility in humans. Gut. Feb 2006; 55(2): 243-251.
Cottrell JJ, et al. Glucagon-like peptide-2 protects against TPN-induced intestinal hexose malabsorption in enterally refed piglets. Am. J. Physiol Gastrointest Liver Physiol. Feb 2006; 290(2): G293-G300.
Stephens J, et al. Glucagon-like peptide-2 acutely increases proximal small intestinal blood flow in TPN-fed neonatal piglets. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2006; 290(2): R283-R289.
Fan H., etc. Molecular mechanism and structural basis of interactions of dipeptidyl peptidase IV with adenosine deaminase and human immunodeficiency virus type-1 transcription transactivator. Eur J Cell Biol.
|