| Name
|
Corticotropin Releasing Factor, Human, Rat
|
| Other Name
|
CRF, human, ratCorticotropin-releasing hormone (CRH)
|
| Sequence (Single letter abbreviations)
|
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
|
| Sequence(Three letter abbreviations)
|
{SER}{GLU}{GLU}{PRO}{PRO}{ILE}{SER}{LEU}{ASP}{LEU}{THR}{PHE}{HIS}{LEU}{LEU}{ARG}{GLU}{VAL}{LEU}{GLU}{MET}{ALA}{ARG}{ALA}{GLU}{GLN}{LEU}{ALA}{GLN}{GLN}{ALA}{HIS}{SER}{ASN}{ARG}{LYS}{LEU}{MET}{GLU}{ILE}{ILE}-NH2
|
| C-port
|
NH2
|
| Basic description
|
Corticotropin-releasing factor (CRF) has been widely implicated as playing a major role in modulating the endocrine, autonomic, behavioral and immune responses to stress. Corticotropin Releasing Factor (CRF) is a hypothalamic peptide that releases adrenocorticotropic hormone (ACTH) and endorphin from the anterior pituitary. Corticotropin Releasing Factor (CRF) is also a neurotransmitter in the central nervous system, and is involved in autonomic and endocrine responses to stress.
|
| Solubility
|
Soluble in water (1 mg/ml), clear and colorless
|
| The molecular weight
|
4757.450
|
| Chemical formula
|
C208H344N60O63S2
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Kita I, et al. Corticotropin-releasing factor neurons in the hypothalamic paraventricular nucleus are involved in arousal/yawning response of rats. Behav. Brain Res. Apr 2006; 169(1): 48-56.
Sahuque LL, et al. Anxiogenic and aversive effects of corticotropin-releasing factor (CRF) in the bed nucleus of the stria terminalis in the rat: role of CRF receptor subtypes. Psychopharmacology (Berl.). May 2006; 186(1): 122-132.
Meloni EG, et al. Behavioral and anatomical interactions between dopamine and corticotropin-releasing factor in the rat. J. Neurosci. Apr 2006; 26(14): 3855-3863.
|