| Name
|
Amylin, Feline
|
| Other Name
|
IAPPDAP
|
| Sequence (Single letter abbreviations)
|
KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2
|
| Sequence(Three letter abbreviations)
|
{LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{ILE}{ARG}{SER}{SER}{ASN}{ASN}{LEU}{GLY}{ALA}{ILE}{LEU}{SER}{PRO}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2
|
| C-port
|
NH2
|
| Chemical bridge
|
Cys2-Cys7
|
| Basic description
|
Amylin is produced in the pancreas beta cells and coreleased with insulin. Amylin's amino acid sequence shows great homology with CGRP. Amylin has been shown to reverse insulin inhibition of hepatic gluconeogenesis and to inhibit muscle uptake of glucose.
|
| Solubility
|
Insoluble in water. Dissolve peptide with 10% Acetonitrile in water.
|
| The molecular weight
|
3912.420
|
| Chemical formula
|
C165H272N52O54S2
|
| The purity
|
> 95%
|
| Storage conditions
|
Lyophilized powder may be stored at 4°C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20°C. Reconstituted product is stable for 24 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
|
| Annotation
|
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
|
| Documents
|
|
| Figures
|
|
| Reference
|
Henseleit KD, et al. NKX6 transcription factor activity is required for alpha- and beta-cell development in the pancreas. Development. Jul 2005; 132(13): 3139-3149.
|