| Name
|
Adrenomedullin (AM) (1-52), Human
|
| Other Name
|
|
| Sequence (Single letter abbreviations)
|
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
|
| Sequence(Three letter abbreviations)
|
{TYR}{ARG}{GLN}{SER}{MET}{ASN}{ASN}{PHE}{GLN}{GLY}{LEU}{ARG}{SER}{PHE}{GLY}{CYS}{ARG}{PHE}{GLY}{THR}{CYS}{THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}{GLY}{TYR}-NH2
|
| C-port
|
NH2
|
| Chemical bridge
|
Disulfide bridge: Cys16-Cys21
|
| Basic description
|
Adrenomedullin (1-52) is a potent hypotensive peptide hormone with some structural similarity to calcitonin gene-related peptide. Adrenomedullin (1-52) has vasodilatory properties.
|
| Solubility
|
The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
|
| The molecular weight
|
6028.900
|
| Chemical formula
|
C264H406N80O77S3
|
| The purity
|
> 95%
|
| Storage conditions
|
Before use, store the peptide in the DRY form at 0-5°C. For and more repeatable results, rehydrate the peptide immediately before use. Do not re-freeze any unused portions.
|
| Documents
|
|
| Figures
|
|
| Reference
|
|