| Name
|
Adrenomedullin (AM) (13-52), Human
|
| Other Name
|
|
| Sequence (Single letter abbreviations)
|
SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
|
| Sequence（Three letter abbreviations）
|
{SER}{PHE}{GLY}{CYS}{ARG}{PHE}{GLY}{THR}{CYS}{THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}{GLY}{TYR}-NH2
|
| C-port
|
NH2
|
| Chemical bridge
|
Disulfide bridge: Cys16-Cys21
|
| Basic description
|
Adrenomedullin (13-52) is a 40 amino acid peptide with one intramolecular disulfide bridge, Adrenomedullin (13-52) is a affinity ligand for the adrenomedullin receptor. |
| The molecular weight
|
4533.200
|
| Chemical formula
|
C200H308N58O59S2
|
| The purity
|
> 95%
|
| Storage conditions
|
Store at -20°C.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Tam CW, et al. Enhanced vascular responses to adrenomedullin in mice overexpressing receptor-activity-modifying protein 2. Circ. Res. Feb 2006; 98(2): 262-70.
|
Adrenomedullin (AM) (13-52), Human
