| Name
|
Adrenocorticotropic Hormone (ACTH) (1-39), Rat
|
| Other Name
|
ACTH (1-39), ratAdrenocorticotropic hormone, rat
|
| Sequence (Single letter abbreviations)
|
SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
|
| Sequence(Three letter abbreviations)
|
{SER}{TYR}{SER}{MET}{GLU}{HIS}{PHE}{ARG}{TRP}{GLY}{LYS}{PRO}{VAL}{GLY}{LYS}{LYS}{ARG}{ARG}{PRO}{VAL}{LYS}{VAL}{TYR}{PRO}{ASN}{VAL}{ALA}{GLU}{ASN}{GLU}{SER}{ALA}{GLU}{ALA}{PHE}{PRO}{LEU}{GLU}{PHE}
|
| Basic description
|
Peptide fragments of ACTH (1-39) were formed during in vitro incubation of the peptide with membrane preparations. ACTH (1-39) were isolated by pressure liquid chromatography, and peptide fragments of ACTH (1-39) characterized by determination of amino acid composition and NH2- terminal residue.
|
| Solubility
|
Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
|
| The molecular weight
|
4582.500
|
| Chemical formula
|
210H315N57O57S1
|
| The purity
|
> 95%
|
| Storage conditions
|
Before using, store the peptide in the DRY form at 0-5°C. For and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Mi-Sun Yum., etc. Prenatal stress promotes development of spasms in infant rats. Epilepsia. 2012 Mar;53(3):e46-9.
|