| Name
|
Adrenocorticotropic Hormone (ACTH) (1-39), Human
|
| Other Name
|
ACTH (1-39), humanCorticotropin
|
| Sequence (Single letter abbreviations)
|
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
|
| Sequence(Three letter abbreviations)
|
{SER}{TYR}{SER}{MET}{GLU}{HIS}{PHE}{ARG}{TRP}{GLY}{LYS}{PRO}{VAL}{GLY}{LYS}{LYS}{ARG}{ARG}{PRO}{VAL}{LYS}{VAL}{TYR}{PRO}{ASN}{GLY}{ALA}{GLU}{ASP}{GLU}{SER}{ALA}{GLU}{ALA}{PHE}{PRO}{LEU}{GLU}{PHE}
|
| Basic description
|
Adrenocorticotropic hormones (ACTH). ACTH stimulates the adrenal cortex and the secretion of glucocorticoids such as cortisol. Another name for ACTH is corticotropin.
|
| Solubility
|
Soluble in water (1 mg/ml), clear, colorless
|
| The molecular weight
|
4541.130
|
| Chemical formula
|
C207H308N56O58S
|
| The purity
|
> 95%
|
| Storage conditions
|
Store the peptide at -20°C.
|
| Annotation
|
|
| Documents
|
|
| Figures
|
|
| Reference
|
Zhou R, et al. Adrenal hyperandrogenism is induced by fetal androgen excess in a rhesus monkey model of polycystic ovary syndrome. J.Clin.Endocrinol.Metab. Dec 2005; 90(12):6630-7.
Tamar Chachua., etc. Validation of the rat model of cryptogenic infantile spasms. Epilepsia. 2011 Sep;52(9):1666-77.
|